PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0164s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 321aa    MW: 36857.5 Da    PI: 8.3174
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0164s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.63e-54101391128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWk 84 
                             +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL+ k k+ +  ++ewyfFs++dkky+tg+r+nrat++g+Wk
  SapurV1A.0164s0070.1.p  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKdKcKIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWK 95 
                             69****************************.9***************943444443456**************************** PP

                     NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             atg+dk+++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  SapurV1A.0164s0070.1.p  96 ATGRDKAIHISNSQRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 139
                             ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-604159IPR003441NAC domain
PROSITE profilePS5100558.25210159IPR003441NAC domain
PfamPF023653.6E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MMTGNGQLSV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIREVDLNKL EPWDLKDKCK  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHISNSQR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLD DDNSEVQEDG WVVCRVFKKK NQTRGFLPEV CQEVHFPHMK  180
ASTSSFPLDP KQNQLQSLYH DYTLDGSMHL PQLFSPDSAV APSFASPLSL NNMNDIERSQ  240
NLLRLTSAGC GFEHPAGRFN GDWSLLDKLL ASHQNLDHQQ IHYQNKRNSS SQIVDPVGTS  300
TQKFPFQYLG FETDILRFSK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-53716417173NAC domain-containing protein 19
3swp_C5e-53716417173NAC domain-containing protein 19
3swp_B5e-53716417173NAC domain-containing protein 19
3swp_A5e-53716417173NAC domain-containing protein 19
3swm_D5e-53716417173NAC domain-containing protein 19
3swm_C5e-53716417173NAC domain-containing protein 19
3swm_B5e-53716417173NAC domain-containing protein 19
3swm_A5e-53716417173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002311276.10.0no apical meristem family protein
SwissprotQ9MA171e-122SMB_ARATH; Protein SOMBRERO
TrEMBLB9HI110.0B9HI11_POPTR; No apical meristem family protein
STRINGPOPTR_0008s07950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-113NAC family protein